EBI-3 human active recombinant protein

EBI-3 human active recombinant protein

€295.00
In stock
SKU
600106
Catalog Number: 600106
Size: 0.02 mg
Datasheet
Request Information
Protein Family: Cytokines

Pathway and Disease: Immune System, Signaling Molecules and Interaction, Cell Communication, Cancers

Alternate Names: Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27BDescription:
Epstein-Barr Virus Induced Gene-3 (EBI-3 or IL-27-beta) is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209 amino acids with a molecular weight of 23.3 kDa.

Source: E. coli. Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

Applications: E, WB

Application Notes:
Assay data for Human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody.

Accession No.: Q14213

MW: 23300 Da

Sequence:
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Purity:
Purity > 90% as determined by reducing and non-reducing SDS-PAGE and analytical HPLC. Protein Content determined by UV spectroscopy at 280 nm and quantitation on SDS-PAGE against a known standard.

Format:
Each vial contains 20 ug of lyophilized protein. Reconstitute with 0.2 ml sterile deionized water for a final concentration of 0.1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:EBI-3 human active recombinant protein