E-Selectin human active recombinant protein

Protein Family: Cellular Antigens, Glycan Binding Proteins, CAM Ligands

Pathway and Disease: Infectious Diseases, Signaling Molecules and Interaction

Alternate Names: E-Selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial, cell adhesion molecule 2, Short name=LECAM2, CD62 antigen-like family member E, CD62EDescription:
E-Selectin is a cell-surface glycoprotein which plays role in immunoadhesion. E-Selectin mediates the adhesion of blood neutrophils in cytokine-activated endothelium through interactions with PSGL1/SELPLG. It also plays a role in capillary morphogenesis. Recombinant human E-selectin comprises a 379 amino acid fragment (179-557) corresponding to the cysteine rich complement control region and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P16581

MW: 45.22 kDa

Sequence:
His-Tag sequence not included: NCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPL

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.