HGF-B human active recombinant protein

Protein Family: Cytokines

Pathway and Disease: Cancers, Cell Communication, Signaling Molecules and Interaction, Infectious Diseases

Alternate Names: Hepatocyte Growth Factor-B, Hepatopoeitin-B, Scatter factor, SF, HPTA, HGFDescription:
Hepatocyte growth factor (HGF) is a potent mitogen for mature parenchymal hepatocyte cells, is a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. It has no detectable protease activity. Hepatocyte growth factor is a dimer of an alpha chain and a beta chain linked by a disulfide bond. Defects in this protein are the cause of deafness autosomal recessive type 39 (DFNB39), a form of profound prelingual sensorineural hearing loss.. Recombinant HGF-B comprises a 234 amino acid fragment (495-728) corresponding to the mature HGF-B protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P14210

MW: 30.12 kDa

Sequence:
His-Tag sequence not included: VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.