I-FABP human active recombinant protein

Protein Family: Chaperones and Folding Catalysts

Pathway and Disease: Energy Metabolism

Alternate Names: I-FABP, Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABPDescription:
Fatty acid binding protein (intestinal) (I-FABP) is involved in triglyceride-rich lipoprotein synthesis. This protein binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. Fatty acid binding protein (intestinal) also helps maintain energy homeostasis by functioning as a lipid sensor. Recombinant I-FABP comprises a 132 amino acid fragment (1-132) corresponding to the human intestinal FABP protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P12104

MW: 19.71 kDa

Sequence:
His-Tag sequence not included: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.