ICA1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What’s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Islet cell autoantigen 1 (ICA1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
69 kDa islet cell autoantigen antibody, Diabetes mellitus type I autoantigen antibody, ICA 1 antibody, Ica1 antibody, ICA69 antibody, ICA69_HUMAN antibody, ICAp69 antibody, Islet cell autoantigen 1 (69kD) antibody, Islet cell autoantigen 1 69kDa antibody, Islet cell autoantigen 1 antibody, Islet cell autoantigen 1 isoform antibody, Islet cell autoantigen p69 antibody, OTTHUMP00000200933 antibody, OTTHUMP00000200934 antibody, OTTHUMP00000200941 antibody, OTTHUMP00000200993 antibody, p69 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.