IL-1 beta rat active recombinant protein

IL-1 beta rat active recombinant protein

€295.00
In stock
SKU
600383
Catalog Number: 600383
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cytokines

Pathway and Disease: Cell Growth and Death, Immune System, Metabolic Disorders, Neurodegenerative Disorders, Signal Transduction, Signaling Molecules and Interaction

Alternate Names: Catabolin, LAF, EP, LEM, MCFDescription:
Interleukin-1 beta (IL-1beta) is a pro-inflammatory cytokine, produced in response to inflammatory agents by a variety of cells, including, monocytes, macrophages, and dendritic cells (DCs). IL-1beta and IL-1alpha are two distinct and independently regulated gene products that comprise IL-1 and signal through the Type 1 IL-1 receptor (IL-1R1). Although IL-1alpha is cell associated and IL-1beta is secreted, they have nearly identical biological activity in that they induce adhesion molecule expression on epithelial cells, control fever induction, and play a role in arthritis and septic shock. Signaling activated by the IL-1R1 promotes these activities through a MYD88 signaling pathway similar to those associated with Toll receptors. Rat IL-1 beta is produced in E.coli. Recombinant rat IL-1beta is a non-glycosylated protein, containing 152 amino acids, with a molecular weight of 17.3 kDa.

Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.

Applications: E, WB

Application Notes:
The activity is determined by the dose-dependent proliferation of mouse D10S cells and is typically less than 1 ng/mL. Specific activity: 1 x 10e6 units/mg

Accession No.: Q63264

MW: 17300 Da

Sequence:
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.

Format:
Each vial contains 10 ug of lyophilized protein. Reconstitute with 0.1 ml sterile deionized water for a final concentration of 0.1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:IL-1 beta rat active recombinant protein