IL-17AF mouse active recombinant protein
€295.00
In stock
SKU
600365
Protein Family: Cytokines
Pathway and Disease: Immune System, Signal Transduction, Signaling Molecules and Interaction
Alternate Names: interleukin-17A, IL-17A, IL-17, Cytotoxic T-lymphocyte-associated antigen 8, IL17A, CTLA8, IL17, Interleukin-17F, IL-17F, Cytokine ML-1, IL17FDescription:
Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells. Mouse IL-17AF is produced in E.coli. Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It is containing one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.
Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
Applications: E, WB
Application Notes:
The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75-325 ng/mL. Specific activity: 1.3 x 10e4 units/mg
Accession No.: Q62386/Q7TNI7
MW: 30700 Da
Sequence:
IL-17A:MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVN AEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA IL-17F:MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Format:
Each vial contains 25 ug of lyophilized protein. Reconstitute with 0.25 ml sterile deionized water for a final concentration of 0.1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
Pathway and Disease: Immune System, Signal Transduction, Signaling Molecules and Interaction
Alternate Names: interleukin-17A, IL-17A, IL-17, Cytotoxic T-lymphocyte-associated antigen 8, IL17A, CTLA8, IL17, Interleukin-17F, IL-17F, Cytokine ML-1, IL17FDescription:
Interleukin-17AF (IL-17AF) is a member of the IL-17 family of proteins produced by a subset of T cells, called Th17, following stimulation with IL-23. Since IL-17AF is thought to signal through the IL-17R receptor, its biological function is similar to that of IL-17A in that it induces the production of a variety of chemokines, in addition to airway neutrophilia. In regard to these functions, IL-17AF has less activity than the IL-17A homodimer but, greater activity than the IL-17F homodimer. Human and rat IL-17AF both show activity on mouse cells. Mouse IL-17AF is produced in E.coli. Recombinant mouse IL-17AF is a non-glycosylated, disulfide-linked heterodimer. It is containing one IL-17A subunit and one IL-17F subunit, with a total of 271 amino acids and an molecular weight of 30.7 kDa.
Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
Applications: E, WB
Application Notes:
The activity is determined by the dose-dependent induction of IL-6 production in cultured mouse NIH 3T3 fibroblasts, is typically 75-325 ng/mL. Specific activity: 1.3 x 10e4 units/mg
Accession No.: Q62386/Q7TNI7
MW: 30700 Da
Sequence:
IL-17A:MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVN AEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA IL-17F:MRKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Format:
Each vial contains 25 ug of lyophilized protein. Reconstitute with 0.25 ml sterile deionized water for a final concentration of 0.1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
| Is Featured? | No |
|---|
Write Your Own Review