IL-17E mouse active recombinant protein
€295.00
In stock
SKU
600364
Protein Family: Cytokines
Pathway and Disease: Immune System, Signal Transduction, Signaling Molecules and Interaction
Alternate Names: interleukin-25, IL-25, 17E, IL-17E, IL25, Interleukin 17EDescription:
Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-kB by binding to the receptor IL-17RB. Mouse IL-17E is produced in E.coli. Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing two 154 amino acid chains, with a total molecular weight of 35.5 kDa.
Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
Applications: E, WB
Application Notes:
The activity is determined by the dose-dependant production of IL-8 from cultured human PBMCs and is typically 10-100 ng/mL. Specific activity: 1 x 10e5 units/mg
Accession No.: Q8VHC9
MW: 35500 Da
Sequence:
MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Format:
Each vial contains 25 ug of lyophilized protein. Reconstitute with 0.25 ml sterile deionized water for a final concentration of 0.1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
Pathway and Disease: Immune System, Signal Transduction, Signaling Molecules and Interaction
Alternate Names: interleukin-25, IL-25, 17E, IL-17E, IL25, Interleukin 17EDescription:
Interleukin-17E (IL-17E), also commonly called IL-25, is a pro-inflammatory cytokine member of a six-species family of proteins (IL-17A-17F). IL-17F stimulates secretion of IL-8 and induces activation of NF-kB by binding to the receptor IL-17RB. Mouse IL-17E is produced in E.coli. Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing two 154 amino acid chains, with a total molecular weight of 35.5 kDa.
Source: E. coli. Endotoxin level as measured by LAL is <0.05ng/ug or <0.5EU/ug.
Applications: E, WB
Application Notes:
The activity is determined by the dose-dependant production of IL-8 from cultured human PBMCs and is typically 10-100 ng/mL. Specific activity: 1 x 10e5 units/mg
Accession No.: Q8VHC9
MW: 35500 Da
Sequence:
MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
Purity:
Purity > 95% as determined by RP-HPLC and reducing and non-reducing SDS-PAGE. Protein Content determined by UV spectroscopy at 280 nm and analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Format:
Each vial contains 25 ug of lyophilized protein. Reconstitute with 0.25 ml sterile deionized water for a final concentration of 0.1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
| Is Featured? | No |
|---|
Write Your Own Review