IL-6 Soluble Receptor human active recombinant protein
€295.00
In stock
SKU
600270
Protein Family: Cytokines
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-6 Soluble Receptor, IL6R-alpha, IL-6R 1, CD126 antigen, IL6RA, interleukin 6 receptor, interleukin 6 receptor alpha subunit, Interleukin-6 receptor alpha chain precursorDescription:
The interleukin-6 receptor (IL-6R) complex is composed of two membrane glycoproteins: the low affinity receptor and the signal transducing component. The soluble form of IL-6R (IL6-sR) is found in the urine of healthy adult humans and the serum of HIV positive individuals, as well as in the cell culture supernatants of stimulated PBMC. This soluble form of IL-6R results from either proteolytic cleavage from the membrane, or an isoform derived splice variant. Recombinant IL6-sR comprises a 161 amino acid fragment (20-357) corresponding to the mature IL6-sR protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P08887
MW: 42.25 kDa
Sequence:
His-Tag sequence not included: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQ
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
Pathway and Disease: Signaling Molecules and Interaction, Signal Transduction, Infectious Diseases, Immune System
Alternate Names: IL-6 Soluble Receptor, IL6R-alpha, IL-6R 1, CD126 antigen, IL6RA, interleukin 6 receptor, interleukin 6 receptor alpha subunit, Interleukin-6 receptor alpha chain precursorDescription:
The interleukin-6 receptor (IL-6R) complex is composed of two membrane glycoproteins: the low affinity receptor and the signal transducing component. The soluble form of IL-6R (IL6-sR) is found in the urine of healthy adult humans and the serum of HIV positive individuals, as well as in the cell culture supernatants of stimulated PBMC. This soluble form of IL-6R results from either proteolytic cleavage from the membrane, or an isoform derived splice variant. Recombinant IL6-sR comprises a 161 amino acid fragment (20-357) corresponding to the mature IL6-sR protein and is expressed in E. coli with an amino-terminal hexahistidine tag.
Source: E. coli
Applications: E, WB
Accession No.: P08887
MW: 42.25 kDa
Sequence:
His-Tag sequence not included: LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQ
Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.
Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.
Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
| Is Featured? | No |
|---|
Write Your Own Review