ILK-1 human active recombinant protein

Protein Family: Protein Kinases, Enzymes

Pathway and Disease: Cell Communication, Cancers, Endocrine System, Infectious Diseases

Alternate Names: Integrin-Linked Kinase, Integrin-linked protein kinase, 59 kDa serine/threonine-protein kinase, ILK-1, ILK-2, p59ILKDescription:
Integrin-linked kinase (ILK-1) acts as a mediator of inside-out integrin signaling. It is part of focal adhesion complex ILK-PINCH, considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Integrin-linked kinase is implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Integrin-linked kinase phosphorylates beta-1 and beta-3 integrin subunits on serine and threonine residues. Recombinant ILK-1 comprises a 452 amino acid fragment (1-452) corresponding to the mature ILK-1 full-length protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: Q13418

MW: 55.92 kDa

Sequence:
His-Tag sequence not included: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.